PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011938.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 323aa    MW: 33850.7 Da    PI: 10.0511
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011938.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.44.3e-353998261
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                +++al+cprC+stntkfCyynn s++qPry+Ck+Crr WtkGG+lrnvPvGg++rknk++
  Do011938.1 39 QDQALNCPRCNSTNTKFCYYNNNSMTQPRYLCKTCRRNWTKGGTLRNVPVGGSSRKNKQQ 98
                7899******************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-243697IPR003851Zinc finger, Dof-type
PfamPF027015.0E-324097IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.7294397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MVASPPREEA AARNVKPKPA RQQQTAASGV RESKPRPQQD QALNCPRCNS TNTKFCYYNN  60
NSMTQPRYLC KTCRRNWTKG GTLRNVPVGG SSRKNKQQRA SAAPLAPSAS SSSSSGSEKV  120
NNVITQKLMT MMPTASAMTT TADFSNILTT FMSTGSGFEL PISDHHQLSM PFTPMSLLSN  180
PNSGSGTTPL SVGMLRGGFL DGSSSNYGAA LSNGMAMPFY PPPSFGPMQH WPGMGGSTTD  240
QHTTQLVGPL MQGVEEVKPM AAVAGGGSIN DGGFAAAGWA GGAVQQQVGD DGGSADNNKA  300
SSRSNTNNNG GASASRSMGY YWQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1177931e-54EF117793.2 Setaria italica clone GB-SIM-002 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954606.19e-95PREDICTED: dof zinc finger protein PBF-like
SwissprotO244631e-51PBF_MAIZE; Dof zinc finger protein PBF
TrEMBLK3YXY97e-95K3YXY9_SETIT; Uncharacterized protein
STRINGSi019139m2e-94(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.14e-33Dof family protein